Products
Search Result
Home >

Products >

peptide toxins neurotoxin online manufacturer Manufacturer

The search yielded  (9)  results

PLTX-II Peptide Toxins Potent Neurotoxin Catalog Number C1100-V

PLTX-II,Lyophilized,Catalog Number: C1100-V, Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective exocytosis inhibitor. Shows insecticidal effects in vivo. Indication for Use: This product if for Research Use Only (RUO). This product is not for administration to humans or animals. This product is not for human or veterinary diagnostic or therapeutic use. Safety: User must review the Material Safety Data Sheet (MSDS) provided

Charybdotoxin Peptide Toxins Inhibitor CAS 95751-30-7 Catalog Number K1080-V

Charybdotoxin,CAS#:95751-30-7,Catalog Number:K1080-V,Store at -20C or -80C KCa1.1, KV1.2, KV1.3 K+ channels, Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1. Chemical properties Family The Charybdotoxin family of scorpion toxins is a group of small peptides that has many family members, such as the pandinotoxin, derived from the

GsMTx-4 Peptide Toxins Catalog Number O1080-V CAS 1209500-46-8

GsMTx-4,Catalog Number: O1080-V,CAS#:1209500-46-8,Lyophilized,Purity95% Mechanosensitive and stretch-activated ion channel inhibitor. Grammostola mechanotoxin #4 (GsMTx-4, GsMTx4, GsMTx-IV), also known as M-theraphotoxin-Gr1a (M-TRTX-Gr1a), is a neurotoxin isolated from the venom of the spider Chilean rose tarantula Grammostola spatulate (or Grammostola rosea).This amphiphilic peptide, which consists of 35 amino acids, belongs to the inhibitory cysteine knot (ICK) peptide

Apamin Bee Venom Peptide Toxins Catalog Number K1090-V

Apamin Catalog Number:K1090-V,Store at -20C or -80C,Lyophilized A Blocker of Small Conductance Ca2+-Activated K+ Channels (SK Type) Apamin is an 18 amino acid globular peptide neurotoxin found in apitoxin (bee venom).Dry bee venom consists of 23% of apamin. Apamin selectively blocks SK channels, a type of Ca2+-activated K+ channel expressed in the central nervous system. Toxicity is caused by only a few amino acids, in particular cysteine1, lysine4, arginine13, arginine14

α-Conotoxin GI Peptide Toxin Potent neurotoxin Catalog Number O1050-V CAS 76862-65-2 Purity≥95%

-conotoxin GI,Catalog Number O1050-V,CAS#:76862-65-2,Lyophilized,Purity95% 1/1// nAChR, -Conotoxin GI inhibits / site on mouse muscle-derived BC3H-1 nicotinic acetylcholine receptors (nAChR) expressed on postsynaptic membranes. Other site (/ site) on nicotinic receptors from Torpedo californica electric organ is also inhibited by -Conotoxin GI. Appearance: White lyophilized solid Solubility: water or saline buffer

Leiurotoxin I Scyllatoxin Neurotoxin Catalog Number K1100-V

Leiurotoxin I,Catalog Number: K1100-V,Store at -20C or -80C,Lyophilized Leiurotoxin-1 (Scyllatoxin) is a neurotoxin that was originally isolated from Leiurus quinquestriatus hebraeus. Leiurotoxin-1 binds and blocks SK channels (small conductance Ca2+-activated K+ channels) in the brain and spinal cord and inhibits them. Target Scyllatoxin is a blocker of small-conductance Ca2+ activated K+ channels at 10131011 M concentrations in various cell types. This toxin shows

Calciseptine,Channel Type:Ca2+ Channel Blocker,CAS#:178805-91-9

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardia contraction inhibitor. Neurotoxic. Active in vivo and in vitro. Calciseptine (CaS) is a natural neurotoxin isolated from the black mamba Dendroaspis p. polylepis venom. This toxin consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type calcium channels, but not other voltage-dependent Ca2+

Lyophilized Protoxin II CAS 165168-50-3 Catalog Number N1030-V

Protoxin II,CAS#:165168-50-3,Catalog Number: N1030-V,Sequence:YCQKWMWTCDSERKCCEGMVCRLWCKKKLW NaV channels and T-type Ca2+ channels, ProTx-II inhibits NaV channels1. ProTx-II could also modulate T-type Ca2+ channels at higher concentrations. Sources Protoxin-II is a neurotoxin that is derived from the venom of the Peruvian green velvet tarantula (Thrixopelma pruriens). Chemistry ProTx-II is a 30-amino acid peptide with a molecular weight of 3826.65 Da. The structure of ProTx

ω-conotoxin GVIA,CAS#:106375-28-4,Lyophilized,Catalog Number: C1030-V

-conotoxin GVIA C120 H182 N38 O43 S6 Ca2+ channel blocker (N type), Synthetic toxin originally isolated from Conus geographus. Specific blocker of Cav2.2 (N-type) Ca2+ channels. Binds to the Cav2.21 subunit (1B) and its action is only partially reversible. Chemical Structure Structure Comments Omega conotoxin GVIA is a peptide neurotoxin composed of 27 amino acid residues with three disulfide bridges. Chemical Formula C120 H182 N38 O43 S6 Properties Physical Properties

1