peptide toxins inhibitor online manufacturer Manufacturer

Charybdotoxin,CAS#:95751-30-7,Catalog Number:K1080-V,Store at -20C or -80C KCa1.1, KV1.2, KV1.3 K+ channels, Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1. Chemical properties Family The Charybdotoxin family of scorpion toxins is a group of small peptides that has many family members, such as the pandinotoxin, derived from the

GsMTx-4,Catalog Number: O1080-V,CAS#:1209500-46-8,Lyophilized,Purity95% Mechanosensitive and stretch-activated ion channel inhibitor. Grammostola mechanotoxin #4 (GsMTx-4, GsMTx4, GsMTx-IV), also known as M-theraphotoxin-Gr1a (M-TRTX-Gr1a), is a neurotoxin isolated from the venom of the spider Chilean rose tarantula Grammostola spatulate (or Grammostola rosea).This amphiphilic peptide, which consists of 35 amino acids, belongs to the inhibitory cysteine knot (ICK) peptide

PLTX-II,Lyophilized,Catalog Number: C1100-V, Selective, irreversible presynaptic voltage-gated Ca2+ channel blocker. Potent neurotoxin. Selective exocytosis inhibitor. Shows insecticidal effects in vivo. Indication for Use: This product if for Research Use Only (RUO). This product is not for administration to humans or animals. This product is not for human or veterinary diagnostic or therapeutic use. Safety: User must review the Material Safety Data Sheet (MSDS) provided

Psalmotoxin 1,Catalog Number: O1120-V,Lyophilized,Purity95% ASIC1a channels, Psalmotoxin-1 inhibits cation currents mediated by acid-sensing ion channels (ASIC1a). Psalmotoxin (PcTx1) is a spider toxin from the venom of the Trinidad tarantula Psalmopoeus cambridgei. It selectively blocks Acid Sensing Ion Channel 1-a (ASIC1a), which is a proton-gated sodium channel. Sources Psalmotoxin is a toxin produced in the venom glands of the South American tarantula Psalmopoeus

Potent, specific L-type Ca2+ channel blocker (IC50 = 15 nM). Inactive on other voltage-dependent Ca2+ channels. Smooth muscle relaxant and cardia contraction inhibitor. Neurotoxic. Active in vivo and in vitro. Calciseptine (CaS) is a natural neurotoxin isolated from the black mamba Dendroaspis p. polylepis venom. This toxin consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type calcium channels, but not other voltage-dependent Ca2+

Protoxin II,CAS#:165168-50-3,Catalog Number: N1030-V,Sequence:YCQKWMWTCDSERKCCEGMVCRLWCKKKLW NaV channels and T-type Ca2+ channels, ProTx-II inhibits NaV channels1. ProTx-II could also modulate T-type Ca2+ channels at higher concentrations. Sources Protoxin-II is a neurotoxin that is derived from the venom of the Peruvian green velvet tarantula (Thrixopelma pruriens). Chemistry ProTx-II is a 30-amino acid peptide with a molecular weight of 3826.65 Da. The structure of ProTx