Leave a Message
We will call you back soon!
Your message must be between 20-3,000 characters!
Please check your E-mail!
SUBMIT
The search yielded (1) results
ShK Toxin,CAS#:172450-46-3,Catalog Number: K1010-V,Sequence:RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC Various KV K+ channels. Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels. Structure ShK is cross-linked by three disulfide bridges: Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32. The solution structure of ShK reveals two short -helices comprising
