Products
Search Result
Home >

Products >

shk toxin 172450 46 3 online manufacturer Manufacturer

The search yielded  (1)  results

ShK Toxin Peptide Toxins CAS 172450-46-3 Catalog Number K1010-V

ShK Toxin,CAS#:172450-46-3,Catalog Number: K1010-V,Sequence:RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC Various KV K+ channels. Stichodactyla Toxin blocks KV1.3, KV1.1, KV1.4, and KV1.6 at subnanomolar concentrations and KV3.2 channels at 1000-fold higher concentration than that required to inhibit KV1.3 channels. Structure ShK is cross-linked by three disulfide bridges: Cys3-Cys35, Cys12-Cys28, and Cys17-Cys32. The solution structure of ShK reveals two short -helices comprising

1