Products
Search Result
Home >

Products >

lyophilized protoxin ii online manufacturer Manufacturer

The search yielded  (1)  results

Lyophilized Protoxin II CAS 165168-50-3 Catalog Number N1030-V

Protoxin II,CAS#:165168-50-3,Catalog Number: N1030-V,Sequence:YCQKWMWTCDSERKCCEGMVCRLWCKKKLW NaV channels and T-type Ca2+ channels, ProTx-II inhibits NaV channels1. ProTx-II could also modulate T-type Ca2+ channels at higher concentrations. Sources Protoxin-II is a neurotoxin that is derived from the venom of the Peruvian green velvet tarantula (Thrixopelma pruriens). Chemistry ProTx-II is a 30-amino acid peptide with a molecular weight of 3826.65 Da. The structure of ProTx

1