Leave a Message
We will call you back soon!
Your message must be between 20-3,000 characters!
Please check your E-mail!
SUBMIT
The search yielded (1) results
GLP-1 (1-37) (human),CAS#: 87805-34-3, Catalog Number: KS032002 GLP, synthesized by posttranslational processing of proglucagon in the intestine and pancreas, plays an important role in metabolic homeostasis. It is capable of converting intestinal epithelial cells into insulin-producing cells, thus serving as a new putative therapeutic compound for the treatment of diabetes mellitus. Technical Data M.Wt: 4169.52 Formula: C186H275N51O59 Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIA
