Products
Search Result
Home >

Products >

human glp1 diabetes online manufacturer Manufacturer

The search yielded  (1)  results

GLP-1 (1-37) (human) Peptides Diabetes CAS 87805-34-3 Catalog No. KS032002

GLP-1 (1-37) (human),CAS#: 87805-34-3, Catalog Number: KS032002 GLP, synthesized by posttranslational processing of proglucagon in the intestine and pancreas, plays an important role in metabolic homeostasis. It is capable of converting intestinal epithelial cells into insulin-producing cells, thus serving as a new putative therapeutic compound for the treatment of diabetes mellitus. Technical Data M.Wt: 4169.52 Formula: C186H275N51O59 Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIA

1