glp 1 diabetes peptides online manufacturer Manufacturer

Exendin-4 (9-39) CAS 133514-43-9 Catalog Number KS031013 This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4. Technical Data for Exendin-3 (9-39) amideM. Wt3369.79FormulaC149H234N40O47SSequence(Modifications: Ser-31 = C

GLP-1 (1-37) (human),Catalog Number: KS032002,CAS NO.: 87805-34-3 GLP, synthesized by posttranslational processing of proglucagon in the intestine and pancreas, plays an important role in metabolic homeostasis. It is capable of converting intestinal epithelial cells into insulin-producing cells, thus serving as a new putative therapeutic compound for the treatment of diabetes mellitus.

GLP-2 (1-34) (human),CAS#: 99120-49-7, Catalog Number: KS032009 Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2

GLP-2 (1-33) (human),CAS#: 223460-79-5, Catalog Number: KS032008 This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function. Technical Data for GLP-2 (human) M. Wt

GLP-1 (1-37) (human),CAS#: 87805-34-3, Catalog Number: KS032002 GLP, synthesized by posttranslational processing of proglucagon in the intestine and pancreas, plays an important role in metabolic homeostasis. It is capable of converting intestinal epithelial cells into insulin-producing cells, thus serving as a new putative therapeutic compound for the treatment of diabetes mellitus. Technical Data M.Wt: 4169.52 Formula: C186H275N51O59 Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIA

Sermaglutide CAS 910463-68-2 Molecular Weight 4113.64 On September 20, 2019, the FDA officially approved the marketing application for Sommarutide, which is used in combination with diet and exercise to improve blood sugar control in patients with type 2 diabetes. Sommarutide is a human GLP-1 analogue with high albumin affinity and a long half-life. It can be administered once a week to stimulate insulin secretion and inhibit glucagon secretion in a glucose-dependent manner.