• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Hormone Peptide

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS061005 Luteinizing Hormone-releasing Factor (swine) Glp-HWSYGLRPG-OH (trifluoroacetate Salt) 35263-73-1 ≥95% (HPLC) $60
    KS061024 Orexin B (human) RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2 (trifluoroacetate Salt) 205640-91-1 ≥95% (HPLC) $231
    KS042001 Somatostatin 14 AGCKNFFWKTFTSC-OH (Disulfide Bridge) 38916-34-6 ≥95% (HPLC) $164
    KS061028 Gastrin Releasing Peptide (Porcine) APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 74815-57-9 ≥95% (HPLC) $222
    KS061004 Oxytocin CYIQNCPLG-NH2 (trifluoroacetate Salt) (Cys1 And 6 Bridge) 50-56-6 ≥95% (HPLC) $109
    KS061017 Luteinizing Hormone-Releasing Hormone Antagonist Ac-D2Nal-f(4-Cl)-beta(3pyridyl)a-GRPa-NH2 (trifluoroacetate Salt) 292141-31-2 ≥95% (HPLC) $195
    KS042005 Peptide YY (human) YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRTY-NH2 (trifluoroacetate Salt) 118997-30-1 ≥95% (HPLC) $297
    KS062018 ANP (1-28); Carperitide SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge) 89213-87-6 ≥95% (HPLC) $346
    KS042004 Peptide YY (canine, Mouse, Porcine, Rat) YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 (trifluoroacetate Salt) 81858-94-8 ≥95% (HPLC) $297
    KS061012 Antileukinate SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH 138559-60-1 ≥95% (HPLC) $36
    KS061019 Vasoactive Intestinal Peptide HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 (trifluoroacetate Salt) 96886-24-7 ≥95% (HPLC) $216
    KS061029 GLP-2 (1-34) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITDR-OH (trifluoroacetate Salt) 99120-49-7 ≥95% (HPLC) $280
    KS061022 Calcitonin (rat) CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (trifluoroacetate Salt) (Cys1 And 7 Bridge) 11118-25-5 ≥95% (HPLC) $395
    KS061030 TRH (Human) Pyr-HP-NH2 (trifluoroacetate Salt) 24305-27-9 ≥95% (HPLC) $18
    KS061020 Orexin B (mouse) RPGPPGLQGRLQRLLQANGNHAAGILTM-NH2 (trifluoroacetate Salt) 202801-92-1 ≥95% (HPLC) $231
    KS042006 Gastrin 1 (human) Glp-GPWLEEEEEAYGWMDF-NH2 10047-33-3 ≥95% (HPLC) $100
    KS032008 GLP-2 (1-33) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH (trifluoroacetate Salt) 223460-79-5 ≥95% (HPLC) $272
    KS061023 Orexin A (human) Glp-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (trifluoroacetate Salt) (Cys6 And 12 Bridge, Cys7 And 14 Bridge) 205640-90-0 ≥95% (HPLC) $1087
    KS061027 Parathyroid Hormone (1-34) (rat) AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF-OH (trifluoroacetate Salt) 98614-76-7 ≥95% (HPLC) $219
    KS042007 Caerulein Glp-QDY(SO3H)TGWMDF-NH2 17650-98-5 ≥95% (HPLC) $71
    1 2 3
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Hormone Peptide

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS061005 Luteinizing Hormone-releasing Factor (swine) Glp-HWSYGLRPG-OH (trifluoroacetate Salt) 35263-73-1 ≥95% (HPLC) $60
    KS061024 Orexin B (human) RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2 (trifluoroacetate Salt) 205640-91-1 ≥95% (HPLC) $231
    KS042001 Somatostatin 14 AGCKNFFWKTFTSC-OH (Disulfide Bridge) 38916-34-6 ≥95% (HPLC) $164
    KS061028 Gastrin Releasing Peptide (Porcine) APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 74815-57-9 ≥95% (HPLC) $222
    KS061004 Oxytocin CYIQNCPLG-NH2 (trifluoroacetate Salt) (Cys1 And 6 Bridge) 50-56-6 ≥95% (HPLC) $109
    KS061017 Luteinizing Hormone-Releasing Hormone Antagonist Ac-D2Nal-f(4-Cl)-beta(3pyridyl)a-GRPa-NH2 (trifluoroacetate Salt) 292141-31-2 ≥95% (HPLC) $195
    KS042005 Peptide YY (human) YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRTY-NH2 (trifluoroacetate Salt) 118997-30-1 ≥95% (HPLC) $297
    KS062018 ANP (1-28); Carperitide SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge) 89213-87-6 ≥95% (HPLC) $346
    KS042004 Peptide YY (canine, Mouse, Porcine, Rat) YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 (trifluoroacetate Salt) 81858-94-8 ≥95% (HPLC) $297
    KS061012 Antileukinate SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH 138559-60-1 ≥95% (HPLC) $36
    KS061019 Vasoactive Intestinal Peptide HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 (trifluoroacetate Salt) 96886-24-7 ≥95% (HPLC) $216
    KS061029 GLP-2 (1-34) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITDR-OH (trifluoroacetate Salt) 99120-49-7 ≥95% (HPLC) $280
    KS061022 Calcitonin (rat) CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 (trifluoroacetate Salt) (Cys1 And 7 Bridge) 11118-25-5 ≥95% (HPLC) $395
    KS061030 TRH (Human) Pyr-HP-NH2 (trifluoroacetate Salt) 24305-27-9 ≥95% (HPLC) $18
    KS061020 Orexin B (mouse) RPGPPGLQGRLQRLLQANGNHAAGILTM-NH2 (trifluoroacetate Salt) 202801-92-1 ≥95% (HPLC) $231
    KS042006 Gastrin 1 (human) Glp-GPWLEEEEEAYGWMDF-NH2 10047-33-3 ≥95% (HPLC) $100
    KS032008 GLP-2 (1-33) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH (trifluoroacetate Salt) 223460-79-5 ≥95% (HPLC) $272
    KS061023 Orexin A (human) Glp-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (trifluoroacetate Salt) (Cys6 And 12 Bridge, Cys7 And 14 Bridge) 205640-90-0 ≥95% (HPLC) $1087
    KS061027 Parathyroid Hormone (1-34) (rat) AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF-OH (trifluoroacetate Salt) 98614-76-7 ≥95% (HPLC) $219
    KS042007 Caerulein Glp-QDY(SO3H)TGWMDF-NH2 17650-98-5 ≥95% (HPLC) $71
    1 2 3