• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Peptides For Scientific Research

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS041016 PHI-27 (rat) HADGVFTSDYSRLLGQISAKKYLESLI-NH2 (trifluoroacetate Salt) 90419-12-8 ≥95% (HPLC) $222
    KS042005 Peptide YY (human) YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRTY-NH2 (trifluoroacetate Salt) 118997-30-1 ≥95% (HPLC) $297
    KS041003 GIP (human) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH 100040-31-1 ≥95% (HPLC) $444
    KS042007 Caerulein Glp-GPWLEEEEEAYGWMDF-NH2 17650-98-5 ≥95% (HPLC) $71
    KS042008 Secretin (porcine) HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 (acetate Salt) 17034-34-3 ≥95% (HPLC) $222
    KS042009 Gastrin-Releasing Peptide (human) VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 93755-85-2 ≥95% (HPLC) $222
    KS042010 VIP Receptor Antagonist (Human, Bovine, Porcine, Rat) HSDAVf(4-Cl)TDNYTRLRKQLAVKKYLNSILNNH2 (trifluoroacetate Salt) 102805-45-8 ≥95% (HPLC) $231
    KS042011 DOTA-[Tyr3]-Octreotide DOTA-fCYwKTCT-ol (trifluoroacetate Salt) (Cys2 And 7 Bridge) 177943-89-4 ≥95% (HPLC) $528
    KS042012 Secretin (human) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) 108153-74-8 ≥95% (HPLC) $222
    KS042014 Motilin (human, Porcine) FVPIFTYGELQRMQEKERNKGQ-OH (trifluoroacetate Salt) 9072-41-7 ≥95% (HPLC) $129
    KS041015 Pancreatic Polypeptide (rat) APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt) 96849-38-6 ≥95% (HPLC) $304
    KS041017 Uroguanylin (human) NDDCELCVNVACTGCL 152175-68-3 ≥95% (HPLC) $95
    KS021014 β-Defensin-1 (human) DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $889
    KS021011 Apelin (1-13) (human) QRPRLSHKGPMPF-OH (trifluoroacetate Salt) 217082-58-1 ≥95% (HPLC) $77
    KS022003 Fusion Inhibitory Peptide Z-fFG-OH 75539-79-6 ≥95% (HPLC) $40
    KS021007 HIV (GP120) Antigenic Peptide CGKIEPLGVAPTKAKRRVVQREKR-OH (trifluoroacetate Salt) 198636-94-1 ≥95% (HPLC) $146
    KS021005 Leupeptin Ac-LLR-CHO (trifluoroacetate Salt) 103476-89-7 ≥95% (HPLC) $22
    KS021001 Influenza Hemagglutinin (HA) Peptide YPYDVPDYA-OH (trifluoroacetate Salt) 92000-76-5 ≥95% (HPLC) $55
    KS021006 Defensin HNP-3 (human) AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL-OH (trifluoroacetate Salt) (Cys4 And Cys31/Cys6 And Cys20/Cys10 And Cys30 Disulfide Bridges) 136661-76-2 ≥95% (HPLC) $765
    KS022004 Malaria Aspartyl Proteinase FRET Substrate(Dabcyl-Edans Pair) DRVYIHPFHL-OH (trifluoroacetate Salt) 263718-22-5 ≥95% (HPLC) $255
    5 6 7 8 9 10 11 12
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Peptides For Scientific Research

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS041016 PHI-27 (rat) HADGVFTSDYSRLLGQISAKKYLESLI-NH2 (trifluoroacetate Salt) 90419-12-8 ≥95% (HPLC) $222
    KS042005 Peptide YY (human) YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRTY-NH2 (trifluoroacetate Salt) 118997-30-1 ≥95% (HPLC) $297
    KS041003 GIP (human) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH 100040-31-1 ≥95% (HPLC) $444
    KS042007 Caerulein Glp-GPWLEEEEEAYGWMDF-NH2 17650-98-5 ≥95% (HPLC) $71
    KS042008 Secretin (porcine) HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 (acetate Salt) 17034-34-3 ≥95% (HPLC) $222
    KS042009 Gastrin-Releasing Peptide (human) VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 93755-85-2 ≥95% (HPLC) $222
    KS042010 VIP Receptor Antagonist (Human, Bovine, Porcine, Rat) HSDAVf(4-Cl)TDNYTRLRKQLAVKKYLNSILNNH2 (trifluoroacetate Salt) 102805-45-8 ≥95% (HPLC) $231
    KS042011 DOTA-[Tyr3]-Octreotide DOTA-fCYwKTCT-ol (trifluoroacetate Salt) (Cys2 And 7 Bridge) 177943-89-4 ≥95% (HPLC) $528
    KS042012 Secretin (human) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) 108153-74-8 ≥95% (HPLC) $222
    KS042014 Motilin (human, Porcine) FVPIFTYGELQRMQEKERNKGQ-OH (trifluoroacetate Salt) 9072-41-7 ≥95% (HPLC) $129
    KS041015 Pancreatic Polypeptide (rat) APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt) 96849-38-6 ≥95% (HPLC) $304
    KS041017 Uroguanylin (human) NDDCELCVNVACTGCL 152175-68-3 ≥95% (HPLC) $95
    KS021014 β-Defensin-1 (human) DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $889
    KS021011 Apelin (1-13) (human) QRPRLSHKGPMPF-OH (trifluoroacetate Salt) 217082-58-1 ≥95% (HPLC) $77
    KS022003 Fusion Inhibitory Peptide Z-fFG-OH 75539-79-6 ≥95% (HPLC) $40
    KS021007 HIV (GP120) Antigenic Peptide CGKIEPLGVAPTKAKRRVVQREKR-OH (trifluoroacetate Salt) 198636-94-1 ≥95% (HPLC) $146
    KS021005 Leupeptin Ac-LLR-CHO (trifluoroacetate Salt) 103476-89-7 ≥95% (HPLC) $22
    KS021001 Influenza Hemagglutinin (HA) Peptide YPYDVPDYA-OH (trifluoroacetate Salt) 92000-76-5 ≥95% (HPLC) $55
    KS021006 Defensin HNP-3 (human) AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL-OH (trifluoroacetate Salt) (Cys4 And Cys31/Cys6 And Cys20/Cys10 And Cys30 Disulfide Bridges) 136661-76-2 ≥95% (HPLC) $765
    KS022004 Malaria Aspartyl Proteinase FRET Substrate(Dabcyl-Edans Pair) DRVYIHPFHL-OH (trifluoroacetate Salt) 263718-22-5 ≥95% (HPLC) $255
    5 6 7 8 9 10 11 12